PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P02680_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 579aa    MW: 65184 Da    PI: 4.9804
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P02680_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.6e-085025401854
                            HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            +F++  ++yps  e+  LA + gLt +qV++WF N R +
  GSMUA_Achr4P02680_001 502 MFQNftHPYPSDGEKNLLALRSGLTRSQVSNWFINARVR 540
                            6886669******************************88 PP

2BELL44.34.6e-15380448472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            e  + k++Ll++l+ Vd +Ykq+ e+++ vis ++ ++     +    +Al++iS  +++L+++i+  i
  GSMUA_Achr4P02680_001 380 ETTREKSQLLTMLQLVDLKYKQCLEEVNGVISLYDDATKSAVPQFSSGFALHTISMLYKNLRERITRSI 448
                            667889***********************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-5303446IPR006563POX domain
PfamPF075261.1E-24311445IPR006563POX domain
PROSITE profilePS5007112.05481544IPR001356Homeobox domain
SuperFamilySSF466893.51E-16483553IPR009057Homeodomain-like
SMARTSM003897.3E-7484548IPR001356Homeobox domain
CDDcd000864.59E-11484545No hitNo description
Gene3DG3DSA:1.10.10.603.2E-26487550IPR009057Homeodomain-like
PfamPF059202.6E-15501540IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MEKDILNAGL SMTDHNHVSM DTIASLFFSG STSQPGIKDQ NFHEQIMSGN TLFPSLQEES  60
HNNVSPAYYG GFLTPVGYAT IDDCVGKNEL EEQTEVPLLS SMPLQYNVAD TNGLEEDFST  120
VNLSSSASFP LQEMKISMPR NNFNVLAMQN VTEVLASKTG GSLNKQFDYV RYSDETLKHQ  180
VPSSTTSIVH PSCYIKEFSK PELCSDILTP KFLSYYTPSN ELSLSLGSSR PSMSKMLDIS  240
DQFSEINCSG IDQVPPKNSR YCSDELGEYS LVVNSLHDVQ LRTGTELGND QHCPGIQEFS  300
TCSGPVNLYG ILTSRYFSVT QQILSEVSSY IQLDDSLSGI SFSSSCSSER EFVITRSMDF  360
QSSFGDIDSQ DHVEKLQALE TTREKSQLLT MLQLVDLKYK QCLEEVNGVI SLYDDATKSA  420
VPQFSSGFAL HTISMLYKNL RERITRSILL VNQQSERKEG RVRAIESSFL QRHWALQQVR  480
RNDWRPKRGL PEKSVSVLRA WMFQNFTHPY PSDGEKNLLA LRSGLTRSQV SNWFINARVR  540
LWKPMIEEMY LELGKRNGGE DGAEEECRSH ETTKVRESS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16490547158Homeobox protein Meis1
4xrs_A2e-16490547158Homeobox protein Meis1
3k2a_B2e-16490548563Homeobox protein Meis2
3k2a_A2e-16490548563Homeobox protein Meis2
4xrm_B3e-16490548563Homeobox protein Meis2
4xrm_A3e-16490548563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395217.10.0PREDICTED: homeobox protein ATH1-like
TrEMBLM0SKI50.0M0SKI5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P02680_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-66homeobox gene 1